1. An avian-derived single-chain antibody against SARS-CoV-2 virus S1 protein, characterized in that its amino acid sequence comprises at least one segment of <210>1, <210>2, <210>3, <210>4, <210>5 and <210> 6.

2. The aviary single-chain antibody against SARS-CoV-2 virus S1 protein according to claim 1, wherein the amino acid sequence thereof comprises at least one segment of <210>7 or <210> 8.

3. The avian-derived single-chain antibody against SARS-CoV-2 virus S1 according to claims 1-2, wherein the single-chain antibody further comprises an antibody obtained by attaching a tag to the N-terminus and/or C-terminus of the single-chain antibody.

4. An isolated nucleic acid molecule, wherein: the nucleic acid molecule is encoded by the monoclonal antibody of any one of claims 1 or 2.

5. A nucleic acid molecule encoding a single chain antibody of avian origin, characterized in that the amino acid sequence thereof comprises at least one segment of <210>7 or <210> 8.

6. The avian-derived single-chain antibody against SARS-CoV-2 virus S1 according to claims 1-2, wherein a mimetic peptide fused with a CDR-FR domain is developed.

7. Use of the avian-derived single-chain antibody against the novel coronavirus SARS-CoV-2 as set forth in any one of claims 1 to 2 for the preparation of a novel coronavirus SARS-CoV-2 detection product.

Background

SARS-CoV-2 belongs to the genus of the beta Coronavirus (Coronavir) of the family Coronaviridae (Coronaviridae), the subfamily orthocoronaviridae (Orthocoronaviridae), and the relatives of the severe acute respiratory syndrome-associated Coronavirus (SARS-CoV) and the middle east respiratory syndrome-associated Coronavirus (MERS-CoV) all cause severe pneumonia symptoms. The virus is transmitted by means of droplets, contact and the like, and latent patients have transmissibility. The research finds that the patients with the new coronary pneumonia have extremely strong infectivity at the early stage of the disease process and the mild symptoms.

The SARS-CoV-2 virus has a diameter of 75-160 nm, its genome is continuous single-stranded RNA, and it successively encodes nucleoprotein (nucleoprotein), envelope protein (envelope protein), membrane protein (membrane protein) and spinous process protein (spike protein, also called S protein or S protein), in which the spinous process protein is the most important protein on its surface, and its main function is to determine host range and specificity of virus, and can be combined with host cell membrane receptor and fused so as to implement infection of cell. The spike protein comprises two subunits of S1 and S2, a Receptor Binding Domain (RBD) in S1 interacts with a human SARS-CoV receptor angiotensin converting enzyme II (ACE2) molecule, and S2 contains essential elements required by a membrane fusion process to realize the fusion of virus and cells. Structurally, in coronaviruses, the spinous process proteins exposed on the surface of the virus, which contain a large number of antigenic determinants, can generate protective antibodies against the virus.

Single chain antibody (scFv) is formed by connecting an antibody heavy chain variable region and an antibody light chain variable region through a short peptide (linker) with 15-20 amino acids. The avian single-chain antibody (IgY-scFv) has more effective virus neutralization effect, and has the advantages that: competitive surface protein of non-specific reaction can be removed, and false positive of antibody detection is avoided; due to the structural difference and phylogenetic distance between IgY and IgG, the poultry scFv has small immunogenicity in mammals; the half-life period of the circulation in the body is short, the circulation is easy to clear, and the detoxification and the discharge are facilitated; the kit is easy to connect with toxin or enzyme genes, is convenient for directly obtaining immunotoxin or enzyme-labeled antibodies and the like for rapid detection, and can make up for the problems of long consumption time, complex detection flow and avoidance of detection window period in the PCR detection process to a certain extent. By selecting scFv genes with higher affinity for the target pathogen through phage display libraries, antibodies produced in poultry are the simplest, most convenient and most efficient method to generate scFv. The method for producing avian IgY-scFv aiming at SARS-CoV-2S protein is more standardized, repeatable and suitable for large-scale production, and effectively inhibits the combination of SARS-CoV-2 and ACE2 on human cell membrane, thereby preventing virus from entering host cell for replication. The specific antibody is developed in a targeted manner, and the specific antibody is very important for detecting SARS-CoV-2 pathogenic microorganism antigens, improving the detection means, enriching the detection method and improving the accuracy, sensitivity and specificity of the detection result.

Therefore, there is a strong need to develop avian-derived single chain antibodies against the S1 protein of SARS-CoV-2 virus.

Disclosure of Invention

In order to solve the problems, the invention aims to provide a monoclonal antibody avian scFv aiming at the novel coronavirus SARS-CoV-2S1 protein and application thereof.

An avian single-chain antibody against SARS-CoV-2 virus S1 protein, which is capable of recognizing SARS-CoV-2 virus S1 protein and comprises complementarity determining regions CDRH1, CDRH2, CDRH3 of heavy chain variable region and complementarity determining regions CDRL1, CDRL2 and CDRL3 of light chain variable region;

the amino acid sequences of the complementarity determining regions CDRH1, CDRH2, CDRH3 of the heavy chain variable region are respectively shown in SEQ ID NO: 1. SEQ ID NO: 2. SEQ ID NO: 3;

the amino acid sequences of the complementarity determining regions CDRL1, CDRL2 and CDRL3 of the light chain variable region are respectively shown in SEQ ID NO: 4. SEQ ID NO: 5. SEQ ID NO: 6.

a poultry single-chain antibody for resisting SARS-CoV-2 virus S1 protein is characterized in that the amino acid sequence is shown in SEQ ID NO: 7 is shown in the specification; or, the amino acid sequence is as shown in SEQ ID NO: shown in fig. 8.

The single-chain antibody also comprises an antibody obtained by connecting a label to the N end and/or the C end of the single-chain antibody.

An isolated nucleic acid molecule comprising SEQ ID NO: 1. SEQ ID NO: 2. SEQ ID NO: 3. SEQ ID NO: 4. SEQ ID NO: 5. SEQ ID NO: 6.

A nucleic acid molecule of an avian-derived single chain antibody comprising a nucleotide sequence encoding SEQ ID NO: 7 and SEQ ID NO: 8.

A single-chain antibody of fowl source for resisting SARS-CoV-2 virus S1 protein, a mimic peptide fused by CDR-FR structure domain is developed.

The application of fowl source single chain antibody aiming at the new coronavirus SARS-CoV-2 in preparing the new coronavirus SARS-CoV-2 detection product.

In order to achieve the purpose, the invention is realized by the following technical scheme:

a monoclonal antibody avian scFv against the novel coronavirus SARS-CoV-2, which specifically binds to the novel coronavirus SARS-CoV-2 spike protein; comprises complementarity determining regions CDRH1, CDRH2, CDRH3 of the heavy chain variable region and complementarity determining regions CDRL1, CDRL2, CDRL3 of the light chain variable region; the amino acid sequences of the complementarity determining regions CDRH1, CDRH2, CDRH3 of the heavy chain variable region are respectively shown in SEQ ID NO: 1. SEQ ID NO: 2. SEQ ID NO: 3; the amino acid sequences of the complementarity determining regions CDRL1, CDRL2 and CDRL3 of the light chain variable region are respectively shown in SEQ ID NO: 4. SEQ ID NO: 5. SEQ ID NO: 6.

the avian scFv of monoclonal antibody against the novel coronavirus SARS-CoV-2 is preferred, and the amino acid sequence of the variable region of the heavy chain of the scFv is shown as SEQ ID NO: 7 is shown in the specification; the amino acid sequence of the light chain variable region is shown as SEQ ID NO: shown in fig. 8.

The invention also includes an isolated nucleic acid molecule encoding a monoclonal antibody aviary scFv of any one of the above.

The invention also includes an expression vector comprising a nucleic acid molecule as described above, which expression vector comprises, in addition to the nucleic acid molecule as described above, an expression control sequence operably linked to the sequence of said nucleic acid molecule.

An expression vector refers to a nucleic acid vehicle into which a polynucleotide encoding an scFv antibody of avian origin can be inserted and the scFv antibody expressed. The vector may be transformed, transduced or transfected into a host cell so that the genetic material elements it carries are expressed within the host cell. Types of vectors include bacterial, bacteriophage, yeast, plant cell viruses, mammalian cell viruses such as adenovirus, retrovirus, or other vectors well known in the art. In principle, any vector may be used as long as it is replicable and stable in the host. In addition to the origin of replication, the expression vector may contain a marker gene and other translational regulatory elements.

The invention also includes a host cell comprising the nucleic acid molecule or the expression vector described above.

The host cell expressing the avian scFv antibody can be a prokaryotic cell, such as a bacterial cell; or lower eukaryotic cells, such as yeast cells; or higher eukaryotic cells, such as mammalian cells. Representative examples are: escherichia coli, Streptomyces; bacterial cells of salmonella typhimurium; fungal cells such as yeast; a plant cell; insect cells of Drosophila S2 or Sf 9; CHO, COS, 293 cells or Bowes melanoma cells.

The invention also comprises an antibody mimic peptide which is designed and generated based on the avian single-chain antibody scFv of the S1 protein of the SARS-CoV-2 virus and fused by the CDR-FR structural domain.

The invention also includes the application of the monoclonal antibody avian scFv aiming at the new coronavirus SARS-CoV-2 in the preparation of the new coronavirus SARS-CoV-2 detection product.

The detection product includes, but is not limited to, a detection reagent, a kit, a chip or a test paper. Any assay product capable of detecting SARS-CoV-2 comprising a binding molecule as described above is included within the scope of the invention.

The terms "new coronavirus SARS-CoV-2" and "SARS-CoV-2 virus", "new coronavirus" and "SARS-CoV-2" used in the present invention can be used interchangeably.

The sequence specific information related to the invention is as follows:

SEQ ID NO: 1 (i.e., <210> 1):

SGGGLQTPGGGLGLVCKAPGFSIGGYIMH

SEQ ID NO: 2 (i.e., <210> 2):

WVRQTPGKGLEYVAGIDAGGGVTWYGAAVKG

SEQ ID NO: 3 (i.e., <210> 3):

RATISRDNGQSTVRLQLNDLRAEDTGIYYCARSTGSDYYDWNYAGEIGA

SEQ ID NO: 4 (i.e., <210> 4):

SGGGGSALTQPSSVSANPGETVKITCSGGGSSSYYG

SEQ ID NO: 5 (i.e., <210> 5):

WYQQKSPGGAPVTVIYSNTGRPS

SEQ ID NO: 6 (i.e., <210> 6):

DIPSRFSGSKSGSTHTLTITGVQVDDEAVYYCGSEDSSTHDGI

SEQ ID NO: 7 (i.e., <210> 7):

SGGGLQTPGGGLGLVCKAPGFSIGGYIMHWVRQTPGKGLEYVAGIDAGGGVTWY GAAVKGRATISRDNGQSTVRLQLNDL

RAEDTGIYYCARSTGSDYYDWNYAGEIGAWGHGTEVIVSS

SEQ ID NO: 8 (i.e., <210> 8):

SGGGGSALTQPSSVSANPGETVKITCSGGGSSSYYGWYQQKSPGGAPVTVIYSNTG RPSDIPSRFSGSKSGSTHTLTITG

VQVDDEAVYYCGSEDSSTHDGIFGAGTTLTVLG

the monoclonal antibody avian scFv aiming at the new coronavirus SARS-CoV-2 has high titer, strong specificity, can be efficiently expressed, can be specifically combined with the S1 protein on the surface of the new coronavirus SARS-CoV-2, and can be used for detecting the new coronavirus SARS-CoV-2.

The phage display technology inserts exogenous DNA into the gene of phage coding coat protein, so that the expression product corresponding to the exogenous DNA fragment is fused in the coat protein of the phage to form fusion protein, and the fusion protein is displayed on the surface of the phage. Has the following remarkable advantages: direct physical connection between the genotype and the phenotype is established, so that the screening is simple, convenient and efficient. The invention screens an avian scFv antibody which can be combined with S1 protein of new coronavirus SARS-CoV-2 from a constructed phage display antibody library, and the antibody has important application value in the aspects of detection of the new coronavirus and reduction of virus toxicity.

Drawings

FIG. 1 is a schematic representation of the variable heavy chain (VL), variable light chain (VL) and PCR results assembled into scFv of avian antibodies; assembling scFv genes;

FIG. 2 is a graph showing the results of an ELISA using 10 phages from a fourth round of panning titer assay plates, with NC being negative control PBS and C being blank control CBS; ELISA detects the binding reaction of scFv-Phage and S1 protein;

FIG. 3 is a schematic diagram showing an alignment between selected 10 monoclonal scFv amino acid sequences; comparing the amino acid sequence similarity of 10 monoclonal scFv;

FIG. 4 is a polyacrylamide gel electrophoresis (SDS-PAGE) analysis of scFv antibodies from monoclonal phage that bind most strongly to S1; expression and purified SDS-PAGE of the highest binding scFv;

FIG. 5 is a diagram showing the results of the specificity and sensitivity detection of scFv and antigen S1 protein; the sensitivity and specificity of scFv antibodies were determined.

Detailed Description

The invention aims to provide a monoclonal antibody avian scFv aiming at a novel coronavirus SARS-CoV-2S1 protein and application thereof, and the invention is further illustrated by the following examples. The examples of the invention are intended to be illustrative and not limiting, and simple modifications thereof in accordance with the principles of the invention are intended to be within the scope of the claims.

Specific example 1 immunization with the novel coronavirus SARS-CoV-2S1 protein

Selecting 60-day-old laying hens with good production state, mixing and emulsifying the new coronavirus SARS-CoV-2S1 protein and the immune adjuvant in equal volume, and performing primary immunization on the hens by four-point intramuscular injection of pectoralis muscle, wherein the immune dose is 200 mug/kg, and the immune adjuvant is complete Freund' S adjuvant. After 14 days of primary immunization, sequentially carrying out four times of boosting immunization on the hens, wherein the interval time of each boosting immunization is 14 days, and when the boosting immunization is carried out, carrying out equal-volume mixing and emulsification on the S1 protein and an immune adjuvant, carrying out the boosting immunization on the hens by four-point intramuscular injection of pectoralis muscles, wherein the immune dose is 250 mu g/hen, and the immune adjuvant is an incomplete Freund adjuvant;

specific example 2 establishment of phage antibody library of avian-derived Single-chain antibody

After five times of immunization of the hens is completed, collecting spleen tissues of the hens, and storing the spleen tissues at the temperature of-80 ℃; and extracting total RNA of the spleen tissue by using a total RNA extraction kit, and performing reverse transcription on the total RNA to obtain spleen tissue cDNA. Respectively amplifying a light chain variable region (VL) and a heavy chain variable region (VH) of an avian egg yolk antibody (IgY) by using two pairs of specific primers and taking spleen tissue cDNA as a template, and then assembling into an avian single chain antibody fragment (scFv) by using an overlapping polymerase chain reaction, wherein the two pairs of specific primers comprise a primer HF-Sif I, a primer HR-Linker, a primer LF-Linker and a primer LR-Not I:

the obtained poultry single-chain antibody fragment scFv is respectively cut by restriction enzymes Sif I and Not I, then the pCANTAB5E phagemid vector is respectively cut by restriction enzymes Sif I and Not I, the cut product is recovered by nucleic acid gel, and the cut poultry single-chain antibody fragment scFv and the cut pCANTAB5E phagemid vector are connected together by T4 DNA ligase. The ligation product was transformed into TG1 E.coli, and spread on SOBAG solid medium to which 2. mu.L of ampicillin and 400. mu.L of a 20 wt% aqueous glucose solution were added, and cultured at 37 ℃ for 12 hours. The colonies on the solid SOBAG medium are eluted by sterile Phosphate Buffer Solution (PBS), 100% sterilized glycerol with the same volume is added, namely TG1 bacterial antibody library, and the bacterial antibody library is stored at-80 ℃ for later use.

3mL of the obtained TG1 bacterial antibody library was added to 250mL of 2 XYT medium containing 5mL of 20 wt% glucose solution, and shaking culture was continued at 37 ℃. Every hour, the bacterial concentration of the culture medium is measured by a spectrophotometer, and the bacterial liquid OD of the culture medium is obtained₆₀₀Adding 1 × 10 to the culture medium when the concentration is 0.4-0.6¹²pfu M13KO7 helper phage and 250. mu.L 100mg/mL ampicillin solution, gentle shaking at 37 ℃ and 100 rpm for 0.5 hour, and further shaking-culturing at 37 ℃ and 220 rpm for 0.5 hourAnd (4) hours. The medium 5000g was centrifuged for 15 minutes, the supernatant was removed to obtain bacterial pellets, and the bacterial pellets were resuspended in 500mL of 2 XYT medium and incubated overnight at 37 ℃ under shaking at 250 rpm. The medium at 5000g centrifugal 20 minutes, supernatant to another sterile conical flask, and to the flask is added 100mL PEG8000/NaCl, ice bath 8 hours to precipitate phage. The solution in the Erlenmeyer flask was centrifuged at 10000g at 4 ℃ for 20 minutes, the supernatant was discarded to obtain a white precipitate, the white precipitate was aseptically resuspended with 500. mu.L, and an equal volume of glycerol was added and stored in a-80 ℃ freezer, which was a phage antibody library.

Specific example 3 panning of phage display antibody libraries

The new coronavirus SARS-CoV-2S1 protein was coated with Carbonate Buffer (CBS) to an enzyme-labeled strip, incubated overnight at 4 ℃, washed 5 times with PBST (0.1% Tween 20 in PBS), blotted dry, washed 5 times with PBS solution, and blotted dry. Adding 5% skimmed milk powder solution into enzyme label strip, sealing at 37 deg.C for 2 hr, washing with PBST 10 times, beating to dry, washing with PBS solution 10 times, and beating to dry. After mixing a 2% skimmed milk powder solution with a phage antibody library for 20 minutes at room temperature for interference elimination, adding the mixed solution into an enzyme label strip, incubating at 37 ℃ for 2 hours at 200 mu L per well, washing with PBST for 10 times, patting dry, washing with a PBS solution for 10 times, and patting dry. mu.L of glycine-HCl (Gly-HCl) (pH 2.2) was added to each well of the plate-labeled strip, shaken for 8min, and immediately neutralized by adding 50. mu.L of Tris-HCl buffer (pH 9.0).

The whole liquid in the enzyme label strip is sucked out and placed in a 1.5mL sterilized centrifuge tube, 10 mu L of the liquid is taken out and diluted by 90 mu L sterilized PBS and stored at 4 ℃ for the determination of titer at night, the rest of the liquid is added into 5mL TG1 bacterial liquid in the logarithmic phase, the liquid is kept for 30 minutes in an incubator at 37 ℃, and then the liquid is shaken for 30 minutes at 220 rpm in a shaking table at 37 ℃. Pouring the bacterial liquid into 100mL 2YT-A culture medium after culturing for 1 hour, and shaking to OD at 37 ℃ and 220 rpm in a shaking table₆₀₀When the concentration is 0.5-0.6, adding M13 helper phage M13KO7 into an erlenmeyer flask, standing in an incubator at 37 ℃ for 15 minutes, shaking in a shaker at 37 ℃ for 30 minutes at 220 rpm, centrifuging at 5000g for 15 minutes,the cells were collected, resuspended in 100mL of 2YT-AK medium and shaken overnight at 30 ℃ at 250 rpm. The next day, the bacterial suspension was dispensed into 3 sterilized 50mL centrifuge tubes, centrifuged at 4 ℃ at 10000g for 15 minutes, the supernatant was transferred to another 3 sterilized 50mL centrifuge tubes, PEG/NaCl was added, and the mixture was allowed to stand on ice for 10 hours. After 10 hours, centrifugation is carried out for 15 minutes at 4 ℃ and 10000g, supernatant is discarded, the precipitate is resuspended in 500 muL of sterilized PBS, 10 muL is taken for titer determination, and after the titration is finished, equivalent glycerol is added and stored in-20 ℃, and the primary amplification library is marked.

Using the primary amplification library for the second round of panning by the same method to obtain a secondary amplification library; applying the second-stage amplification library to a third-stage elutriation to obtain a third-stage amplification library; and (4) applying the third-stage amplification library to the fourth-stage panning, and adding 100 glycerol into the fourth-stage amplification library for freezing and storing at the temperature of-80 ℃.

EXAMPLE 4 expression and purification of specific Single chain antibodies

Randomly picking 10 monoclonals from the SOBAG solid culture medium after the fourth panning, respectively culturing in 5mL 2 XYT culture medium for 12 hours, selecting a specific anti-new coronavirus SARS-CoV-2S1 protein single-chain antibody bacterial strain through a phage enzyme-linked immunosorbent assay, and obtaining genes, wherein the 2 XYT culture medium contains ampicillin.

The obtained specific anti-new coronavirus SARS-CoV-2S1 protein single-chain antibody gene and pET-30a vector are respectively subjected to enzyme digestion for 2 hours by restriction enzymes BamH I and Hind III to obtain enzyme digestion products, the enzyme digestion products are connected together by T4 DNA ligase to form recombinant plasmid, and the recombinant plasmid is transformed into BL21(DE3) competent cells. 900 mul of sterile and antibiotic-free LB medium was added to the competent cells, mixed well and then resuscitated for 1 hour at 37 ℃ and 220 rpm on a constant temperature shaking table. Centrifuging the recovered bacterial liquid for 1 hour by 3000g, discarding 900 mu L of supernatant, uniformly coating the rest 100 mu L of mixture suspension precipitate on an LB solid culture medium plate, and inverting at the constant temperature of 37 ℃ for overnight culture.

The next day, a single colony is picked from a solid medium plate and inoculated in 3mL LB liquid medium, and the shaking culture is carried out on a constant temperature shaking table at 37 ℃ and 220 r/min for 12 hours to obtain bacterial liquid. Then, the ratio of 1: 100 switchingCulturing in 150mL LB medium at 37 deg.C and 220 rpm under shaking to OD of bacterial liquid₆₀₀To 0.6, IPTG was added to the medium at 37 ℃ and 220 rpm, and the mixture was cultured with shaking for 5 hours. Centrifuging the bacterial liquid at 12000g at 4 ℃ for 10 minutes, collecting bacterial precipitates, washing the bacterial precipitates twice by using PBS, then re-suspending the precipitates by using 10mL PBS to obtain a mixed liquid, and then placing the mixed liquid on ice to crack the bacterial by using an ultrasonic crusher until the bacterial liquid is clear. The obtained clarified bacterial liquid is centrifuged for 10 minutes at 12000g and 4 ℃, the supernatant is collected and is resuspended and precipitated by PBS, and the poultry single-chain antibody scFv of the specificity anti-new coronavirus SARS-CoV-2S1 protein is obtained.

Specific example 5 ELISA detection of scFv and SARS-CoV-2S1 protein binding force

An indirect ELISA method is established by taking SARS-CoV-2S1 protein as antigen and scFv as primary antibody and anti-His label monoclonal antibody as secondary antibody, and antigen coating concentration, primary antibody dilution, incubation time of confining liquid, secondary antibody dilution and color development time are optimized.

Preparing S1 protein into diluents with different dilution ratios by CBS solution, adding 100 mu L/hole of the diluent into a 96-hole enzyme label plate for coating, incubating overnight at 4 ℃, discarding liquid in the hole, and washing by PBST for 4 times; blocking with 2% BSA 300. mu.L/well, PBST washing 4 times; adding scFv protein solutions with different dilution ratios, incubating at 37 ℃ for 1.5 hours, and washing with PBST for 4 times; horseradish peroxidase (HRP) -labeled anti-His tag monoclonal antibody was labeled with PBS 1: diluting with 5000, adding 100 μ L of the solution into each well, incubating at 37 deg.C for 1.5 hr, and washing with PBST for 4 times; adding freshly prepared TMB-H₂O₂Substrate solution 100. mu.L/well, placing in water bath at 60 ℃ for 15 minutes in dark place, PBST washing 4 times, and finally adding 50. mu.L of 2M H₂SO₄The reaction was stopped and the OD measured with a microplate reader at a wavelength of 450nm, three times per well.

Specific example 6 design and Generation of avian Single chain antibody IgY-scFv mimetic peptides

Using the CDR and framework region sequences of the monoclonal antibody avian-derived single chain antibody IgY-scFv against SARS-CoV-2S1 protein, an antibody mimetic peptide was created comprising CDRs derived from two interacting VH- (VHCDR1) and VL- (VLCDR3), and framework region (VHFR 2). The mimic peptide is synthesized by a solid phase method, the purity of the mimic peptide is determined by an HPLC method, and the molecular weight of the mimic peptide is determined by a mass spectrometry method.

<110> university of Shanxi science

<120> avian single-chain antibody for resisting SARS-CoV-2 virus S1 protein and application thereof

<141>

<160> 8

<210> 1

<211> 29

<212> amino acid sequence

<213> anti SARS-CoV-2S1 protein avian single chain antibody heavy chain variable region complementarity determining region CDRH1

<220>

<221> misc_feature

<223> anti SARS-CoV-2S1 albumen avian single chain antibody heavy chain variable region complementary determining region CDRH1 amino acid sequence

<400> SGGGLQTPGGGLGLVCKAPGFSIGGYIMH

<210> 2

<211> 31

<212> amino acid sequence

<213> anti SARS-CoV-2S1 protein avian single chain antibody heavy chain variable region complementarity determining region CDRH2

<220>

<221> misc_feature

<223> anti SARS-CoV-2S1 albumen avian single chain antibody heavy chain variable region complementary determining region CDRH2 amino acid sequence

<400> WVRQTPGKGLEYVAGIDAGGGVTWYGAAVKG

<210> 3

<211> 49

<212> amino acid sequence

<213> anti SARS-CoV-2S1 protein avian single chain antibody heavy chain variable region complementarity determining region CDRH3

<220>

<221> misc_feature

<223> anti SARS-CoV-2S1 albumen avian single chain antibody heavy chain variable region complementary determining region CDRH3 amino acid sequence

<400> RATISRDNGQSTVRLQLNDLRAEDTGIYYCARSTGSDYYDWNYAGEIGA

<210> 4

<211> 36

<212> amino acid sequence

<213> anti SARS-CoV-2S1 protein avian single-chain antibody light chain variable region complementarity determining region CDRL1

<220>

<221> misc_feature

<223> anti SARS-CoV-2S1 albumen bird single chain antibody light chain variable region complementary determining region CDRL1 amino acid sequence

<400> SGGGGSALTQPSSVSANPGETVKITCSGGGSSSYYG

<210> 5

<211> 23

<212> amino acid sequence

<213> anti SARS-CoV-2S1 protein avian single-chain antibody light chain variable region complementarity determining region CDRL2

<220>

<221> misc_feature

<223> anti SARS-CoV-2S1 albumen bird single chain antibody light chain variable region complementary determining region CDRL2 amino acid sequence

<400> WYQQKSPGGAPVTVIYSNTGRPS

<210> 6

<211> 43

<212> amino acid sequence

<213> anti SARS-CoV-2S1 protein avian single-chain antibody light chain variable region complementarity determining region CDRL3

<220>

<221> misc_feature

<223> anti SARS-CoV-2S1 albumen bird single chain antibody light chain variable region complementary determining region CDRL3 amino acid sequence

<400> DIPSRFSGSKSGSTHTLTITGVQVDDEAVYYCGSEDSSTHDGI

<210> 7

<211> 120

<212> amino acid sequence

<213> anti SARS-CoV-2S1 albumen bird single chain antibody heavy chain variable region VH

<220>

<221> misc_feature

<223> anti SARS-CoV-2S1 albumen bird single chain antibody heavy chain variable region VH amino acid sequence

<400> SGGGLQTPGGGLGLVCKAPGFSIGGYIMHWVRQTPGKGLEYVAGIDAGGGVTWYGAAVKGRATISRDNGQSTVRLQLNDLRAEDTGIYYCARSTGSDYYDWNYAGEIGAWGHGTEVIVSS

<210> 8

<211> 113

<212> amino acid sequence

<213> anti SARS-CoV-2S1 albumen bird single chain antibody light chain variable region VL

<220>

<221> misc_feature

<223> anti SARS-CoV-2S1 albumen bird single chain antibody light chain variable region VL amino acid sequence

<400> SGGGGSALTQPSSVSANPGETVKITCSGGGSSSYYGWYQQKSPGGAPVTVIYSNTGRPSDIPSRFSGSKSGSTHTLTITGVQVDDEAVYYCGSEDSSTHDGIFGAGTTLTVLG